"PECR" Related Products

Expand

Recombinant Human PECR, His-tagged

Cat.No.: PECR-29165TH
Product Overview: Recombinant full length Human PECR with N terminal His tag; 327 amino acids with tag, Predicted MWt 35.1 kDa.
Description: Peroxisomal trans-2-enoyl-CoA reductase is an enzyme that in humans is encoded by the PECR gene.
Protein length: 303 amino acids
Conjugation: HIS
Molecular Weight: 35.100kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.88% Sodium chloride, 10% Glycerol
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLL QGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLK SAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLD TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTF YMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSW GQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITG QSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKET FKEKAKL
Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name: PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens ]
Official Symbol: PECR
Synonyms: PECR; peroxisomal trans-2-enoyl-CoA reductase; HSA250303; SDR29C1; short chain dehydrogenase/reductase family 29C; member 1; TERP;
Gene ID: 55825
mRNA Refseq: NM_018441
Protein Refseq: NP_060911
MIM: 605843
Uniprot ID: Q9BY49
Chromosome Location: 2q35
Pathway: Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Mitochondrial LC-Fatty Acid Beta-Oxidation, organism-specific biosystem; Peroxisome, organism-specific biosystem;
Function: nucleotide binding; oxidoreductase activity; trans-2-enoyl-CoA reductase (NADPH) activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.