Recombinant Human PECR, His-tagged
Cat.No. : | PECR-29165TH |
Product Overview : | Recombinant full length Human PECR with N terminal His tag; 327 amino acids with tag, Predicted MWt 35.1 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Peroxisomal trans-2-enoyl-CoA reductase is an enzyme that in humans is encoded by the PECR gene. |
Protein length : | 303 amino acids |
Conjugation : | HIS |
Molecular Weight : | 35.100kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.88% Sodium chloride, 10% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMASWAKGRSYLAPGLL QGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLK SAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLD TFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTF YMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARA GVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSW GQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITG QSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKET FKEKAKL |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name : | PECR peroxisomal trans-2-enoyl-CoA reductase [ Homo sapiens ] |
Official Symbol : | PECR |
Synonyms : | PECR; peroxisomal trans-2-enoyl-CoA reductase; HSA250303; SDR29C1; short chain dehydrogenase/reductase family 29C; member 1; TERP; |
Gene ID : | 55825 |
mRNA Refseq : | NM_018441 |
Protein Refseq : | NP_060911 |
MIM : | 605843 |
Uniprot ID : | Q9BY49 |
Chromosome Location : | 2q35 |
Pathway : | Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Mitochondrial LC-Fatty Acid Beta-Oxidation, organism-specific biosystem; Peroxisome, organism-specific biosystem; |
Function : | nucleotide binding; oxidoreductase activity; trans-2-enoyl-CoA reductase (NADPH) activity; |
Products Types
◆ Recombinant Protein | ||
PECR-6628M | Recombinant Mouse PECR Protein, His (Fc)-Avi-tagged | +Inquiry |
PECR-4030R | Recombinant Rat PECR Protein, His (Fc)-Avi-tagged | +Inquiry |
PECR-1644H | Recombinant Human PECR Protein, His (Fc)-Avi-tagged | +Inquiry |
Pecr-495M | Recombinant Mouse Pecr Protein, MYC/DDK-tagged | +Inquiry |
PECR-2480Z | Recombinant Zebrafish PECR | +Inquiry |
◆ Lysates | ||
PECR-3309HCL | Recombinant Human PECR 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PECR Products
Required fields are marked with *
My Review for All PECR Products
Required fields are marked with *
0
Inquiry Basket