"PFDN5" Related Products

Expand

Recombinant Human PFDN5, His-tagged

Cat.No.: PFDN5-28100TH
Product Overview: Recombinant full length Human PFDN5 with N terminal His tag; 174 amino acids with tag, Predicted MWt 19.5 kDa.
Description: This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein length: 154 amino acids
Conjugation: HIS
Molecular Weight: 19.500kDa inclusive of tags
Source: E. coli
Tissue specificity: Highly expressed in pancreas and skeletal muscle and moderately in other tissues.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKN QLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNE GKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAED AKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMS QKIQQLTALGAAQATAKA
Sequence Similarities: Belongs to the prefoldin subunit alpha family.
Gene Name: PFDN5 prefoldin subunit 5 [ Homo sapiens ]
Official Symbol: PFDN5
Synonyms: PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5;
Gene ID: 5204
mRNA Refseq: NM_002624
Protein Refseq: NP_002615
MIM: 604899
Uniprot ID: Q99471
Chromosome Location: 12q13.13
Pathway: Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function: protein binding; transcription corepressor activity; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.