Recombinant Human PFDN5, His-tagged
Cat.No. : | PFDN5-28100TH |
Product Overview : | Recombinant full length Human PFDN5 with N terminal His tag; 174 amino acids with tag, Predicted MWt 19.5 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 154 amino acids |
Conjugation : | HIS |
Molecular Weight : | 19.500kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Highly expressed in pancreas and skeletal muscle and moderately in other tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKN QLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNE GKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAED AKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMS QKIQQLTALGAAQATAKA |
Sequence Similarities : | Belongs to the prefoldin subunit alpha family. |
Gene Name : | PFDN5 prefoldin subunit 5 [ Homo sapiens ] |
Official Symbol : | PFDN5 |
Synonyms : | PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5; |
Gene ID : | 5204 |
mRNA Refseq : | NM_002624 |
Protein Refseq : | NP_002615 |
MIM : | 604899 |
Uniprot ID : | Q99471 |
Chromosome Location : | 12q13.13 |
Pathway : | Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function : | protein binding; transcription corepressor activity; unfolded protein binding; |
Products Types
◆ Recombinant Protein | ||
PFDN5-6652M | Recombinant Mouse PFDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFDN5-2580H | Recombinant Human PFDN5 Protein, His-tagged | +Inquiry |
PFDN5-6432H | Recombinant Human PFDN5 Protein(2-154aa), GST-tagged | +Inquiry |
PFDN5-3200R | Recombinant Rhesus Macaque PFDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFDN5-359H | Recombinant Human PFDN5, His-tagged | +Inquiry |
◆ Lysates | ||
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket