Recombinant Human PGF
Cat.No. : | PGF-30907TH |
Product Overview : | Recombinant full length Human PLGF expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a growth factor found in placenta which is homologous to vascular endothelial growth factor. Alternatively spliced transcripts encoding different isoforms have been found for this gene. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:LPAVPPQQWALSAGNGSSEVEVVPFQEVW GRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTG CCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFS QHVRCECRPLREKMKPERCGDAVPRR |
Gene Name : | PGF placental growth factor [ Homo sapiens ] |
Official Symbol : | PGF |
Synonyms : | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; |
Gene ID : | 5228 |
mRNA Refseq : | NM_001207012 |
Protein Refseq : | NP_001193941 |
MIM : | 601121 |
Uniprot ID : | P49763 |
Chromosome Location : | 14q24.3 |
Pathway : | Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function : | growth factor activity; heparin binding; |
Products Types
◆ Recombinant Protein | ||
PGF-100H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-102H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-2583H | Recombinant Human PGF Protein, His-tagged | +Inquiry |
PGF-226H | Recombinant Human PlGF-3 Protein | +Inquiry |
PGF-4065R | Recombinant Rat PGF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket