"PGK1" Related Products

Expand
Expand

Recombinant Human PGK1, His-tagged

Cat.No.: PGK1-30893TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-409 of Human PGK1 with N terminal His tag. MWt 47kDa;
Description: The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. This gene lies on the X-chromosome, while a related pseudogene also has been found on the X-chromosome and another on chromosome 19.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))MSLSNKLTLDKLDVKGKRVVMRVDFN VPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHL GRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEV EKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKA EPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVA DKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLF DEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENA KTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQI VWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIG GGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLP
Sequence Similarities: Belongs to the phosphoglycerate kinase family.
Gene Name: PGK1 phosphoglycerate kinase 1 [ Homo sapiens ]
Official Symbol: PGK1
Synonyms: PGK1; phosphoglycerate kinase 1;
Gene ID: 5230
mRNA Refseq: NM_000291
Protein Refseq: NP_000282
MIM: 311800
Uniprot ID: P00558
Chromosome Location: Xq13.3
Pathway: Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem;
Function: ATP binding; nucleotide binding; phosphoglycerate kinase activity; phosphoglycerate kinase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.