"PHB" Related Products

Expand
Expand

Recombinant Human PHB

Cat.No.: PHB-29709TH
Product Overview: Recombinant full length Human Prohibitin with an N terminal proprietary tag; Predicted MWt 55.66 kDa inclusive of tag.
Description: Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA.
Protein length: 272 amino acids
Molecular Weight: 55.660kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed in different tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ
Sequence Similarities: Belongs to the prohibitin family.
Gene Name: PHB prohibitin [ Homo sapiens ]
Official Symbol: PHB
Synonyms: PHB; prohibitin; PHB1;
Gene ID: 5245
mRNA Refseq: NM_002634
Protein Refseq: NP_002625
MIM: 176705
Uniprot ID: P35232
Chromosome Location: 17q21
Function: histone deacetylase binding; protein binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.