Recombinant Human PHB
Cat.No. : | PHB-29709TH |
Product Overview : | Recombinant full length Human Prohibitin with an N terminal proprietary tag; Predicted MWt 55.66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Prohibitin is an evolutionarily conserved gene that is ubiquitously expressed.It is thought to be a negative regulator of cell proliferation and may be a tumor suppressor.Mutations in PHB have been linked to sporadic breast cancer.Prohibitin is expressed as two transcripts with varying lengths of 3 untranslated region.The longer transcript is present at higher levels in proliferating tissues and cells, suggesting that this longer 3 untranslated region may function as a trans-acting regulatory RNA. |
Protein length : | 272 amino acids |
Molecular Weight : | 55.660kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed in different tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVVFD RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVIT GSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAAT FGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVV EKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK LEAAGDIAYQLSRSRNITYLPAGQSVLLQLPQ |
Sequence Similarities : | Belongs to the prohibitin family. |
Gene Name : | PHB prohibitin [ Homo sapiens ] |
Official Symbol : | PHB |
Synonyms : | PHB; prohibitin; PHB1; |
Gene ID : | 5245 |
mRNA Refseq : | NM_002634 |
Protein Refseq : | NP_002625 |
MIM : | 176705 |
Uniprot ID : | P35232 |
Chromosome Location : | 17q21 |
Function : | histone deacetylase binding; protein binding; transcription regulatory region DNA binding; |
Products Types
◆ Recombinant Protein | ||
PHB-1938H | Recombinant Human PHB Protein, His&GST-tagged | +Inquiry |
PHB-6677M | Recombinant Mouse PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PHB-4077R | Recombinant Rat PHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PHB-2606M | Recombinant Mouse PHB Protein (41-173 aa), His-tagged | +Inquiry |
Phb-4832M | Recombinant Mouse Phb Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
PHB-3241HCL | Recombinant Human PHB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket