Recombinant Human PHOSPHO2, His-tagged
Cat.No. : | PHOSPHO2-29980TH |
Product Overview : | Recombinant full length Human PHOSPHO2 with N terminal His tag; 265 amino acids with tag, Predicted MWt 30.3 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Pyridoxal phosphate phosphatase PHOSPHO2, orphan 2, also known as PHOSPHO2, belongs to the haloacid dehalogenase(HAD) superfamily. Phosphatase has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). |
Protein length : | 241 amino acids |
Conjugation : | HIS |
Molecular Weight : | 30.300kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDD NSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLG DKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCII ISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTV ENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVY IGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLE PMEYSVVVWSSGVDIISHLQFLIKD |
Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. PHOSPHO family. |
Gene Name : | PHOSPHO2 phosphatase, orphan 2 [ Homo sapiens ] |
Official Symbol : | PHOSPHO2 |
Synonyms : | PHOSPHO2; phosphatase, orphan 2; pyridoxal phosphate phosphatase PHOSPHO2; MGC22679; |
Gene ID : | 493911 |
mRNA Refseq : | NM_001199286 |
Protein Refseq : | NP_001186215 |
Uniprot ID : | Q8TCD6 |
Chromosome Location : | 2q31.1 |
Pathway : | Metabolic pathways, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem; Vitamin B6 metabolism, conserved biosystem; |
Function : | hydrolase activity; metal ion binding; pyridoxal phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PHOSPHO2-6708M | Recombinant Mouse PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHOSPHO2-4090R | Recombinant Rat PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHOSPHO2-3231R | Recombinant Rhesus Macaque PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHOSPHO2-6264Z | Recombinant Zebrafish PHOSPHO2 | +Inquiry |
PHOSPHO2-3413R | Recombinant Rhesus monkey PHOSPHO2 Protein, His-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket