"PLEK" Related Products

Expand
Expand

Recombinant Human PLEK

Cat.No.: PLEK-30882TH
Product Overview: Recombinant full length Human Pleckstrin (amino acids 1-350) with a N terminal proprietary tag: predicted MW 67.10 kDa.
Description: Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids.
Protein length: 350 amino acids
Molecular Weight: 67.100kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKS DNSPKGMIPLKGSTLTSPCQDFGKRMFVFKITTTKQQDHF FQAAFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRL PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENSSDDDVILKEE FRGVIIKQGCLLKQGHRRKNWKVRKFILREDPAYLHYYDP AGAEDPLGAIHLRGCVVTSVESNSNGRKSEEENLFEIITA DEVHYFLQAATPKERTEWIKAIQMASRTGK
Sequence Similarities: Contains 1 DEP domain.Contains 2 PH domains.
Gene Name: PLEK pleckstrin [ Homo sapiens ]
Official Symbol: PLEK
Synonyms: PLEK; pleckstrin; P47;
Gene ID: 5341
mRNA Refseq: NM_002664
Protein Refseq: NP_002655
MIM: 173570
Uniprot ID: P08567
Chromosome Location: 2p13.3
Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem;
Function: phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein homodimerization activity; protein kinase C binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.