Recombinant Human PLSCR1
Cat.No. : | PLSCR1-30296TH |
Product Overview : | Recombinant full length Human Scramblase 1 with N terminal proprietary tag; Predicted MWt 61.09 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Phospholipid scramblase 1 is an enzyme that in humans is encoded by the PLSCR1 gene. |
Protein length : | 318 amino acids |
Molecular Weight : | 61.090kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYP GPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGA AGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVL TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPF TLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPG VPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCC GDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQ FPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW |
Sequence Similarities : | Belongs to the phospholipid scramblase family. |
Gene Name : | PLSCR1 phospholipid scramblase 1 [ Homo sapiens ] |
Official Symbol : | PLSCR1 |
Synonyms : | PLSCR1; phospholipid scramblase 1; MMTRA1B; |
Gene ID : | 5359 |
mRNA Refseq : | NM_021105 |
Protein Refseq : | NP_066928 |
MIM : | 604170 |
Uniprot ID : | O15162 |
Chromosome Location : | 3q23 |
Pathway : | EGFR1 Signaling Pathway, organism-specific biosystem; |
Function : | CD4 receptor binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; SH3 domain binding; calcium ion binding; calcium ion binding; |
Products Types
◆ Recombinant Protein | ||
PLSCR1-3296R | Recombinant Rhesus Macaque PLSCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLSCR1-6859M | Recombinant Mouse PLSCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLSCR1-4194R | Recombinant Rat PLSCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLSCR1-3478R | Recombinant Rhesus monkey PLSCR1 Protein, His-tagged | +Inquiry |
PLSCR1-12989M | Recombinant Mouse PLSCR1 Protein | +Inquiry |
◆ Lysates | ||
PLSCR1-3096HCL | Recombinant Human PLSCR1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket