"PLSCR1" Related Products

Expand
Expand
Expand

Recombinant Human PLSCR1

Cat.No.: PLSCR1-30296TH
Product Overview: Recombinant full length Human Scramblase 1 with N terminal proprietary tag; Predicted MWt 61.09 kDa.
Description: Phospholipid scramblase 1 is an enzyme that in humans is encoded by the PLSCR1 gene.
Protein length: 318 amino acids
Molecular Weight: 61.090kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYP GPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGA AGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVL TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPF TLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPG VPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCC GDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQ FPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW
Sequence Similarities: Belongs to the phospholipid scramblase family.
Gene Name: PLSCR1 phospholipid scramblase 1 [ Homo sapiens ]
Official Symbol: PLSCR1
Synonyms: PLSCR1; phospholipid scramblase 1; MMTRA1B;
Gene ID: 5359
mRNA Refseq: NM_021105
Protein Refseq: NP_066928
MIM: 604170
Uniprot ID: O15162
Chromosome Location: 3q23
Pathway: EGFR1 Signaling Pathway, organism-specific biosystem;
Function: CD4 receptor binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; SH3 domain binding; calcium ion binding; calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.