Recombinant Human PNPLA6, His-tagged
Cat.No. : | PNPLA6-29926TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1132-1366 of Human NTE with an N terminal His tag; Predicted MWt 27 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Mutations in this gene result in autosomal recessive spastic paraplegia, and the protein is the target for neurodegeneration induced by organophosphorus compounds and chemical warfare agents. Multiple transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in brain, placenta, kidney, neuron and skeletal muscle. |
Form : | Lyophilised:Reconstitute with 108 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLL WKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSS SYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGG WSRGNVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDL AEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSR DEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSA TDA |
Sequence Similarities : | Belongs to the NTE family.Contains 3 cyclic nucleotide-binding domains.Contains 1 patatin domain. |
Gene Name : | PNPLA6 patatin-like phospholipase domain containing 6 [ Homo sapiens ] |
Official Symbol : | PNPLA6 |
Synonyms : | PNPLA6; patatin-like phospholipase domain containing 6; neuropathy target esterase; NTE; sws; |
Gene ID : | 10908 |
mRNA Refseq : | NM_001166114 |
Protein Refseq : | NP_001159586 |
MIM : | 603197 |
Uniprot ID : | Q8IY17 |
Chromosome Location : | 19p13.2 |
Pathway : | Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem; |
Function : | hydrolase activity; lysophospholipase activity; |
Products Types
◆ Recombinant Protein | ||
PNPLA6-2408H | Recombinant Human PNPLA6 Protein, MYC/DDK-tagged | +Inquiry |
PNPLA6-1726H | Recombinant Human PNPLA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PNPLA6-6890M | Recombinant Mouse PNPLA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pnpla6-4973M | Recombinant Mouse Pnpla6 Protein, Myc/DDK-tagged | +Inquiry |
PNPLA6-3804C | Recombinant Chicken PNPLA6 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionMolecular biology and biochemical methods, such as yeast two-hybridization, affinity chromatography, mass spectrometry, etc., can be used to study the interaction network of PNPLA6. These methods can help us understand the function and mechanism of action of PNPLA6 in cells.
The interaction of PNPLA6 with other proteins or molecules is not fully understood. However, based on its structural and functional characteristics, it can be speculated that it may interact with some enzymes, transcription factors, or other signal transduction molecules to participate in lipid metabolism and cell signaling processes.
Cell models with PNPLA6 overexpression or knockout can be established by gene transfection. The vector of the gene of interest or a specific knockout gene is introduced into the cells, and the stably expressed or knocked out cell line is obtained through screening and identification.
Mutations in PNPLA6 may have a variety of effects on cells, such as affecting lipid metabolism, causing abnormal cell proliferation, and inducing apoptosis. These effects may be related to the occurrence of some diseases, such as neurological diseases, metabolic diseases, etc.
PNPLA6 can be used as a biomarker for disease diagnosis and as a therapeutic target. For example, inhibitors targeting PNPLA6 can be used to treat certain disorders associated with abnormal lipid metabolism, while overexpression may be associated with certain neurological disorders.
The expression regulation mechanism of PNPLA6 involves multiple levels, including transcriptional level, post-transcriptional level, translation level and post-translational level. These regulatory mechanisms work together to ensure that the expression level of PNPLA6 in cells remains stable.
Customer Reviews (3)
Write a reviewThey have a wide range of products to meet our needs in different fields of study.
It is not easy to inactivate, and it is still active after trying a variety of experimental conditions.
The sensitivity is extremely high, the experimental results are very good, and unnecessary troubles are reduced.
Ask a Question for All PNPLA6 Products
Required fields are marked with *
My Review for All PNPLA6 Products
Required fields are marked with *
Inquiry Basket