Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human PNPLA6, His-tagged

Cat.No. : PNPLA6-29926TH
Product Overview : Recombinant fragment, corresponding to amino acids 1132-1366 of Human NTE with an N terminal His tag; Predicted MWt 27 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Mutations in this gene result in autosomal recessive spastic paraplegia, and the protein is the target for neurodegeneration induced by organophosphorus compounds and chemical warfare agents. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in brain, placenta, kidney, neuron and skeletal muscle.
Form : Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLL WKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSS SYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGG WSRGNVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDL AEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSR DEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSA TDA
Sequence Similarities : Belongs to the NTE family.Contains 3 cyclic nucleotide-binding domains.Contains 1 patatin domain.
Gene Name : PNPLA6 patatin-like phospholipase domain containing 6 [ Homo sapiens ]
Official Symbol : PNPLA6
Synonyms : PNPLA6; patatin-like phospholipase domain containing 6; neuropathy target esterase; NTE; sws;
Gene ID : 10908
mRNA Refseq : NM_001166114
Protein Refseq : NP_001159586
MIM : 603197
Uniprot ID : Q8IY17
Chromosome Location : 19p13.2
Pathway : Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem;
Function : hydrolase activity; lysophospholipase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
How to study the interaction network of PNPLA6? 06/27/2022

Molecular biology and biochemical methods, such as yeast two-hybridization, affinity chromatography, mass spectrometry, etc., can be used to study the interaction network of PNPLA6. These methods can help us understand the function and mechanism of action of PNPLA6 in cells.

How does PNPLA6 interact with other proteins or molecules? 05/13/2022

The interaction of PNPLA6 with other proteins or molecules is not fully understood. However, based on its structural and functional characteristics, it can be speculated that it may interact with some enzymes, transcription factors, or other signal transduction molecules to participate in lipid metabolism and cell signaling processes.

How do I model PNPLA6 overexpression or knockout cells? 10/09/2021

Cell models with PNPLA6 overexpression or knockout can be established by gene transfection. The vector of the gene of interest or a specific knockout gene is introduced into the cells, and the stably expressed or knocked out cell line is obtained through screening and identification.

How does a mutation in PNPLA6 affect cells? 11/13/2020

Mutations in PNPLA6 may have a variety of effects on cells, such as affecting lipid metabolism, causing abnormal cell proliferation, and inducing apoptosis. These effects may be related to the occurrence of some diseases, such as neurological diseases, metabolic diseases, etc.

What are the applications of PNPLA6 in disease diagnosis and treatment? 09/29/2020

PNPLA6 can be used as a biomarker for disease diagnosis and as a therapeutic target. For example, inhibitors targeting PNPLA6 can be used to treat certain disorders associated with abnormal lipid metabolism, while overexpression may be associated with certain neurological disorders.

What is the regulatory mechanism of PNPLA6 expression? 06/19/2020

The expression regulation mechanism of PNPLA6 involves multiple levels, including transcriptional level, post-transcriptional level, translation level and post-translational level. These regulatory mechanisms work together to ensure that the expression level of PNPLA6 in cells remains stable.

Customer Reviews (3)

Write a review
Reviews
03/11/2022

    They have a wide range of products to meet our needs in different fields of study.

    08/10/2021

      It is not easy to inactivate, and it is still active after trying a variety of experimental conditions.

      08/13/2020

        The sensitivity is extremely high, the experimental results are very good, and unnecessary troubles are reduced.

        Ask a Question for All PNPLA6 Products

        Required fields are marked with *

        My Review for All PNPLA6 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends