Recombinant Human POLR1C, His-tagged

• Cat.No.: POLR1C-28614TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-174 of Human POLR1C with N terminal His tag; MWt 20kDa.

Specification

• Description: The protein encoded by this gene is a subunit of both RNA polymerase I and RNA polymerase III complexes. The encoded protein is part of the Pol core element. Defects in this gene have been associated with Treacher Collins syndrome (TCS).
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 128 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAW DQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRR ILLAEVPTMAVEKVLVYNNTSIVQDEILAHRLGLIPIH ADPRLFEYRNQGDEEGTEIDTLQFRLQVRCTRNPHAAK DSSDPNELYVNHKVYTRHMT

Gene Information

• Gene Name: POLR1C polymerase (RNA) I polypeptide C, 30kDa [ Homo sapiens ]
• Official Symbol: POLR1C
• Synonyms: POLR1C; polymerase (RNA) I polypeptide C, 30kDa; DNA-directed RNA polymerases I and III subunit RPAC1; RPA5; RPA39; RPA40; RPAC1
• Gene ID: 9533
• mRNA Refseq: NM_203290
• Protein Refseq: NP_976035
• MIM: 610060
• Uniprot ID: O15160
• Chromosome Location: 6p21.1
• Pathway: Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem
• Function: DNA binding; DNA-directed RNA polymerase activity; protein dimerization activity