"PPP2R5D" Related Products

Expand

Recombinant Human PPP2R5D

Cat.No.: PPP2R5D-29540TH
Product Overview: Recombinant fragment corresponding to amino acids 514-602 of Human PPP2R5D with N terminal proprietary tag; predicted MWt 35.42 kDa inclusive of tag.
Description: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a delta isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length: 89 amino acids
Molecular Weight: 35.420kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL
Gene Name: PPP2R5D protein phosphatase 2, regulatory subunit B, delta [ Homo sapiens ]
Official Symbol: PPP2R5D
Synonyms: PPP2R5D; protein phosphatase 2, regulatory subunit B, delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform , protein phosphatase 2, regulatory subunit B, delta isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
Gene ID: 5528
mRNA Refseq: NM_006245
Protein Refseq: NP_006236
MIM: 601646
Uniprot ID: Q14738
Chromosome Location: 6p21.1
Pathway: Activated TLR4 signalling, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Alpha-synuclein signaling, organism-specific biosystem; Aurora A signaling, organism-specific biosystem; Aurora B signaling, organism-specific biosystem;
Function: protein binding; protein phosphatase type 2A regulator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.