"PPP3CA" Related Products

Expand

Recombinant Human PPP3CA, His-tagged

Cat.No.: PPP3CA-26743TH
Product Overview: Recombinant full length Human Calcineurin A Isoform 2 with an N terminal His tag; 534 amino acids with tag, MWt 60.0 kDa.
Protein length: 511 amino acids
Conjugation: HIS
Molecular Weight: 60.000kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHTGSMSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSNGSNSSNIQ
Sequence Similarities: Belongs to the PPP phosphatase family. PP-2B subfamily.
Gene Name: PPP3CA protein phosphatase 3, catalytic subunit, alpha isozyme [ Homo sapiens ]
Official Symbol: PPP3CA
Synonyms: PPP3CA; protein phosphatase 3, catalytic subunit, alpha isozyme; CALN, CALNA, protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform , protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform (calcineurin A alpha); serine/thr
Gene ID: 5530
mRNA Refseq: NM_000944
Protein Refseq: NP_000935
MIM: 114105
Uniprot ID: Q08209
Chromosome Location: 4q24
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem;
Function: calcium ion binding; calcium-dependent protein serine/threonine phosphatase activity; calmodulin binding; hydrolase activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.