"PPP5C" Related Products

Expand
Expand
Expand

Recombinant Human PPP5C, His-tagged

Cat.No.: PPP5C-27638TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-499 of Human PP5 with N terminal His tag, 58kDa.
Description: This gene encodes a serine/threonine phosphatase which is a member of the protein phosphatase catalytic subunit family. Proteins in this family participate in pathways regulated by reversible phosphorylation at serine and threonine residues; many of these pathways are involved in the regulation of cell growth and differentiation. The product of this gene has been shown to participate in signaling pathways in response to hormones or cellular stress, and elevated levels of this protein may be associated with breast cancer development. Alternative splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitous.
Form: Lyophilised:Reconstitute with 140 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFK AKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECY GYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAAL RDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAG DEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMK ELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLK ETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNG DFVDRGSFSVEVILTLFGFKLLYPDHFHLLRGNHETDN MNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCING KVLIMHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDL LWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYI HLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM
Sequence Similarities: Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.Contains 3 TPR repeats.
Gene Name: PPP5C protein phosphatase 5, catalytic subunit [ Homo sapiens ]
Official Symbol: PPP5C
Synonyms: PPP5C; protein phosphatase 5, catalytic subunit; PPP5; serine/threonine-protein phosphatase 5; PP5;
Gene ID: 5536
mRNA Refseq: NM_001204284
Protein Refseq: NP_001191213
MIM: 600658
Uniprot ID: P53041
Chromosome Location: 19q13.3
Pathway: ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem;
Function: hydrolase activity; identical protein binding; metal ion binding; protein binding; protein serine/threonine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.