"PRF1" Related Products

Expand

Recombinant Human PRF1

Cat.No.: PRF1-30288TH
Product Overview: Recombinant full length Human Perforin with a proprietary N-terminal tag, molecular weight 84.85 kDa inclusive of tag
Description: The protein encoded by this gene has structural and functional similarities to complement component 9 (C9). Like C9, this protein creates transmembrane tubules and is capable of lysing non-specifically a variety of target cells. This protein is one of the main cytolytic proteins of cytolytic granules, and it is known to be a key effector molecule for T-cell- and natural killer-cell-mediated cytolysis. Defects in this gene cause familial hemophagocytic lymphohistiocytosis type 2 (HPLH2), a rare and lethal autosomal recessive disorder of early childhood. Alternative splicing results in multiple transcript variants encoding the same protein.
Protein length: 534 amino acids
Molecular Weight: 84.850kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPV DTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSG CQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPTS NVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSF HVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGT HFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVE AQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHS EVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDY TLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPC PPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTF IQAWGLWGDWFTATDAYVKLFLGGQELRTSTVWDNNNPIW SVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAP KSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQM LLGEPPGNRSGAVW
Sequence Similarities: Belongs to the complement C6/C7/C8/C9 family.Contains 1 C2 domain.Contains 1 EGF-like domain.Contains 1 MACPF domain.
Gene Name: PRF1 perforin 1 (pore forming protein) [ Homo sapiens ]
Official Symbol: PRF1
Synonyms: PRF1; perforin 1 (pore forming protein); perforin-1; HPLH2; P1; Perforin; perforin 1 (preforming protein); PFP;
Gene ID: 5551
mRNA Refseq: NM_001083116
Protein Refseq: NP_001076585
MIM: 170280
Uniprot ID: P14222
Chromosome Location: 10q22
Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Apoptosis, organism-specific biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem;
Function: calcium ion binding; protein binding; wide pore channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.