"PRPH" Related Products

Expand

Recombinant Human PRPH

Cat.No.: PRPH-30642TH
Product Overview: Recombinant full length Human Peripherin with an N terminal proprietary tag; Predicted MWt 77.77 kDa inclusive of tag.
Description: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin, and is a different protein that the peripherin found in photoreceptors. Mutations in this gene have been associated with susceptibility to amyotrophic lateral sclerosis.
Protein length: 470 amino acids
Molecular Weight: 77.770kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSHHPSGLRAGFSSTSYRRTFGPPPSLSPGAFSYSSSSRF SSSRLLGSASPSSSVRLGSFRSPRAGAGALLRLPSERLDF SMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQ QNAALRGELSQARGQEPARADQLCQQELRELRRELELLGR ERDRVQVERDGLAEDLAALKQRLEEETRKREDAEHNLVLF RKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQ VSVESQQVQQVEVEATVKPELTAALRDIRAQYESIAAKNL QEAEEWYKSKYADLSDAANRNHEALRQAKQEMNESRRQIQ SLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAAR LEEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLL EGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLI KTIETRNGEVVTESQKEQRSELDKSSAHSY
Sequence Similarities: Belongs to the intermediate filament family.
Gene Name: PRPH peripherin [ Homo sapiens ]
Official Symbol: PRPH
Synonyms: PRPH; peripherin; NEF4; PRPH1;
Gene ID: 5630
mRNA Refseq: NM_006262
Protein Refseq: NP_006253
MIM: 170710
Uniprot ID: P41219
Chromosome Location: 12q12-q13
Pathway: Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function: structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.