Recombinant Human PSMA2, His-tagged

• Cat.No.: PSMA2-31102TH
• Product Overview: Recombinant fragment, corresponding to amino acids 3-234 of Human Proteasome 20S alpha 2 with N terminal His tag; 232 amino acids, 28kDa.

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 57 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAAN GVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMG PDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAW KATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLK ESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
• Sequence Similarities: Belongs to the peptidase T1A family.

Gene Information

• Gene Name: PSMA2 proteasome (prosome, macropain) subunit, alpha type, 2 [ Homo sapiens ]
• Official Symbol: PSMA2
• Synonyms: PSMA2; proteasome (prosome, macropain) subunit, alpha type, 2; proteasome subunit alpha type-2; HC3; MU; PMSA2
• Gene ID: 5683
• mRNA Refseq: NM_002787
• Protein Refseq: NP_002778
• MIM: 176842
• Uniprot ID: P25787
• Chromosome Location: 7p13
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; protein binding; threonine-type endopeptidase activity