Recombinant Human PSMA5

• Cat.No.: PSMA5-29976TH
• Product Overview: Recombinant fragment corresponding to amino acids 132-241 of Human Proteasome 20S alpha 5 with a N terminal proprietary tag, predicted MW: 37.73 kDa inclusive of tag. P28066,

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in fetal brain (at protein level).
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIG SASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLN ATNIELATVQPGQNFHMFTKEELEEVIKDI
• Sequence Similarities: Belongs to the peptidase T1A family.

Gene Information

• Gene Name: PSMA5 proteasome (prosome, macropain) subunit, alpha type, 5 [ Homo sapiens ]
• Official Symbol: PSMA5
• Synonyms: PSMA5; proteasome (prosome, macropain) subunit, alpha type, 5; proteasome subunit alpha type-5; ZETA
• Gene ID: 5686
• mRNA Refseq: NM_001199772
• Protein Refseq: NP_001186701
• MIM: 176844
• Uniprot ID: P28066
• Chromosome Location: 1p13
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; protein binding; threonine-type endopeptidase activity