"PSMA5" Related Products

Expand
Expand

Recombinant Human PSMA5

Cat.No.: PSMA5-29976TH
Product Overview: Recombinant fragment corresponding to amino acids 132-241 of Human Proteasome 20S alpha 5 with a N terminal proprietary tag, predicted MW: 37.73 kDa inclusive of tag. P28066,
Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in fetal brain (at protein level).
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIG SASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLN ATNIELATVQPGQNFHMFTKEELEEVIKDI
Sequence Similarities: Belongs to the peptidase T1A family.
Gene Name: PSMA5 proteasome (prosome, macropain) subunit, alpha type, 5 [ Homo sapiens ]
Official Symbol: PSMA5
Synonyms: PSMA5; proteasome (prosome, macropain) subunit, alpha type, 5; proteasome subunit alpha type-5; ZETA;
Gene ID: 5686
mRNA Refseq: NM_001199772
Protein Refseq: NP_001186701
MIM: 176844
Uniprot ID: P28066
Chromosome Location: 1p13
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;
Function: peptidase activity; protein binding; threonine-type endopeptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.