Recombinant Human PSMB3, His-tagged

• Cat.No.: PSMB3-31208TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-205 of Human Proteasome beta 6, with an N-terminal His tag, 225aa, 25.1 kDa.

Specification

• Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Pseudogenes have been identified on chromosomes 2 and 12.
• Protein length: 246 amino acids
• Conjugation: HIS
• Molecular Weight: 25.100kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 50% Glycerol, 1.17% Sodium chloride
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSIMSYNGGAVMAMKGKNCV AIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRF GPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSG TCAEQMYGMCESLWEPNMDPDHLFETISQAMLNAVDRDAV SGMGVIVHIIEKDKITTRTLKARMD
• Sequence Similarities: Belongs to the peptidase T1B family.

Gene Information

• Gene Name: PSMB3 proteasome (prosome, macropain) subunit, beta type, 3 [ Homo sapiens ]
• Official Symbol: PSMB3
• Synonyms: PSMB3; proteasome (prosome, macropain) subunit, beta type, 3; proteasome subunit beta type-3; HC10 II; MGC4147
• Gene ID: 5691
• mRNA Refseq: NM_002795
• Protein Refseq: NP_002786
• MIM: 602176
• Uniprot ID: P49720
• Chromosome Location: 17q12
• Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem
• Function: peptidase activity; threonine-type endopeptidase activity