Recombinant Human PSMD8
Cat.No. : | PSMD8-30431TH |
Product Overview : | Recombinant fragment of Human PSMD8 with N terminal proprietary tag; Predicted MW 54.27 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. A pseudogene has been identified on chromosome 1. |
Protein length : | 257 amino acids |
Molecular Weight : | 54.270kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTG TKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKC YYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELE RLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPA ESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPST ELAKQVIEYARQLEMIV |
Sequence Similarities : | Belongs to the proteasome subunit S14 family. |
Gene Name : | PSMD8 proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 [ Homo sapiens ] |
Official Symbol : | PSMD8 |
Synonyms : | PSMD8; proteasome (prosome, macropain) 26S subunit, non-ATPase, 8; 26S proteasome non-ATPase regulatory subunit 8; HIP6; HYPF; Nin1p; p31; Rpn12; S14; |
Gene ID : | 5714 |
mRNA Refseq : | NM_002812 |
Protein Refseq : | NP_002803 |
Uniprot ID : | P48556 |
Chromosome Location : | 19q13.2 |
Pathway : | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
PSMD8-2636H | Recombinant Human PSMD8 Protein, His-tagged | +Inquiry |
Psmd8-5199M | Recombinant Mouse Psmd8 Protein, Myc/DDK-tagged | +Inquiry |
PSMD8-358Z | Recombinant Zebrafish PSMD8 | +Inquiry |
◆ Lysates | ||
PSMD8-2744HCL | Recombinant Human PSMD8 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All PSMD8 Products
Required fields are marked with *
My Review for All PSMD8 Products
Required fields are marked with *
0
Inquiry Basket