"PSME2" Related Products

Expand
Expand

Recombinant Human PSME2, His-tagged

Cat.No.: PSME2-30433TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-239 of Human PSME2, with an N-terminal His tag, 259aa, 29.5 kDa.
Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway.An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the beta subunit of the 11S regulator, one of the two 11S subunits that is induced by gamma-interferon. Three beta and three alpha subunits combine to form a heterohexameric ring. Six pseudogenes have been identified on chromosomes 4, 5, 8, 10 and 13.
Protein length: 239 amino acids
Conjugation: HIS
Molecular Weight: 29.500kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAKPCGVRLSGEARKQVEVF RQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSL RAPLDIPIPDPPPKDDEMETDKQEKKEVPKCGFLPGNEKV LSLLALVKPEVWTLKEKCILVITWIQHLIPKIEDGNDFGV AIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHII SSNLEKIVNPKGEEKPSMY
Sequence Similarities: Belongs to the PA28 family.
Gene Name: PSME2 proteasome (prosome, macropain) activator subunit 2 (PA28 beta) [ Homo sapiens ]
Official Symbol: PSME2
Synonyms: PSME2; proteasome (prosome, macropain) activator subunit 2 (PA28 beta); proteasome activator complex subunit 2; PA28beta;
Gene ID: 5721
mRNA Refseq: NM_002818
Protein Refseq: NP_002809
MIM: 602161
Uniprot ID: Q9UL46
Chromosome Location: 14q11.2
Pathway: APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem; APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1, organism-specific biosystem; Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.