"PUM1" Related Products

Expand

Recombinant Human PUM1, His-tagged

Cat.No.: PUM1-31264TH
Product Overview: Recombinant fragment, corresponding to amino acids 1005-1186 of Human Pumilio 1 with N terminal His tag; 182 amino acids, 25kDa.
Description: This gene encodes a member of the PUF family, evolutionarily conserved RNA-binding proteins related to the Pumilio proteins of Drosophila and the fem-3 mRNA binding factor proteins of C. elegans. The encoded protein contains a sequence-specific RNA binding domain comprised of eight repeats and N- and C-terminal flanking regions, and serves as a translational regulator of specific mRNAs by binding to their 3 untranslated regions. The evolutionarily conserved function of the encoded protein in invertebrates and lower vertebrates suggests that the human protein may be involved in translational regulation of embryogenesis, and cell development and differentiation. Alternatively spliced transcript variants encoding different isoforms have been described.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 89 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: YGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNY VIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVV EKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHI LAKLEKYYMKNGVDLGPICGPPNGII
Gene Name: PUM1 pumilio homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol: PUM1
Synonyms: PUM1; pumilio homolog 1 (Drosophila); pumilio (Drosophila) homolog 1; pumilio homolog 1; KIAA0099; PUMH1;
Gene ID: 9698
mRNA Refseq: NM_001020658
Protein Refseq: NP_001018494
MIM: 607204
Uniprot ID: Q14671
Chromosome Location: 1p35.2
Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function: RNA binding; binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.