Recombinant Human RAB1B, His-tagged
Cat.No. : | RAB1B-30221TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-201 of Human RAB1B with a N terminal His tag; 24 kDa: |
- Specification
- Gene Information
- Related Products
Description : | Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 120 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYIST IGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYY RGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNK LLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNAT NVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVK PAGGGCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name : | RAB1B RAB1B, member RAS oncogene family [ Homo sapiens ] |
Official Symbol : | RAB1B |
Synonyms : | RAB1B; RAB1B, member RAS oncogene family; ras-related protein Rab-1B; |
Gene ID : | 81876 |
mRNA Refseq : | NM_030981 |
Protein Refseq : | NP_112243 |
MIM : | 612565 |
Uniprot ID : | Q9H0U4 |
Chromosome Location : | 11q13.1 |
Pathway : | Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; |
Function : | GTP binding; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
RAB1B-1258H | Recombinant Human RAB1B Protein (M1-C201), Tag Free | +Inquiry |
RAB1B-577C | Recombinant Cynomolgus Monkey RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab1b-5295M | Recombinant Mouse Rab1b Protein, Myc/DDK-tagged | +Inquiry |
RAB1B-3554R | Recombinant Rhesus Macaque RAB1B Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB1B-1259H | Recombinant Human RAB1B Protein (M1-C201), His/Strep tagged | +Inquiry |
◆ Lysates | ||
RAB1B-2622HCL | Recombinant Human RAB1B 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket