Recombinant Human RAB32, His-tagged
Cat.No. : | RAB32-28750TH |
Product Overview : | Recombinant full length Human RAB32 with N terminal His tag; 249 amino acids with tag, Predicted MWt 27.6 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al. |
Protein length : | 225 amino acids |
Conjugation : | HIS |
Molecular Weight : | 27.600kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAA PAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY RATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRV YYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPN GSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK LDQETLRAENKSQCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rab family. |
Gene Name : | RAB32 RAB32, member RAS oncogene family [ Homo sapiens ] |
Official Symbol : | RAB32 |
Synonyms : | RAB32; RAB32, member RAS oncogene family; ras-related protein Rab-32; |
Gene ID : | 10981 |
mRNA Refseq : | NM_006834 |
Protein Refseq : | NP_006825 |
MIM : | 612906 |
Uniprot ID : | Q13637 |
Chromosome Location : | 6q24.2 |
Function : | GTP binding; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
RAB32-3562R | Recombinant Rhesus Macaque RAB32 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rab32-5308M | Recombinant Mouse Rab32 Protein, Myc/DDK-tagged | +Inquiry |
RAB32-1109H | Active Recombinant Human RAB32, Member RAS Oncogene Family | +Inquiry |
RAB32-5049C | Recombinant Chicken RAB32 | +Inquiry |
RAB32-3745R | Recombinant Rhesus monkey RAB32 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
RAB32-2607HCL | Recombinant Human RAB32 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RAB32 Products
Required fields are marked with *
My Review for All RAB32 Products
Required fields are marked with *
0
Inquiry Basket