"RAB32" Related Products

Recombinant Human RAB32, His-tagged

Cat.No.: RAB32-28750TH
Product Overview: Recombinant full length Human RAB32 with N terminal His tag; 249 amino acids with tag, Predicted MWt 27.6 kDa.
Description: Small GTP-binding proteins of the RAB family, such as RAB32, play essential roles in vesicle and granule targeting (Bao et al.
Protein length: 225 amino acids
Conjugation: HIS
Molecular Weight: 27.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely expressed with high levels in heart, liver, kidney, bone marrow, testis, colon and fetal lung.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.08% DTT, 50% Glycerol, 1.17% Sodium chloride, 0.06% EDTA
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMAGGGAGDPGLGAAAA PAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHY RATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRV YYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPN GSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFE TSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIK LDQETLRAENKSQCC
Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.
Gene Name: RAB32 RAB32, member RAS oncogene family [ Homo sapiens ]
Official Symbol: RAB32
Synonyms: RAB32; RAB32, member RAS oncogene family; ras-related protein Rab-32;
Gene ID: 10981
mRNA Refseq: NM_006834
Protein Refseq: NP_006825
MIM: 612906
Uniprot ID: Q13637
Chromosome Location: 6q24.2
Function: GTP binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.