"RAB3D" Related Products

Expand

Recombinant Human RAB3D, His-tagged

Cat.No.: RAB3D-31275TH
Product Overview: Recombinant full length Human Rab3D with an N terminal His tag; 239 amino acids with tag, Predicted MWt 26.4 kDa.
Description: Ras-related protein Rab-3D, also known as GOV, is a member of the Ras superfamily of small Rab GTPases. Rab proteins play an important role for, either in endocytosis or in biosynthetic protein transport.
Protein length: 219 amino acids
Conjugation: HIS
Molecular Weight: 26.400kDa inclusive of tags
Source: E. coli
Tissue specificity: Highly expressed in granulocytes of peripheral blood. Constitutively expressed at low levels in all hematopoietic cell lines investigated.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC
Sequence Similarities: Belongs to the small GTPase superfamily. Rab family.
Gene Name: RAB3D RAB3D, member RAS oncogene family [ Homo sapiens ]
Official Symbol: RAB3D
Synonyms: RAB3D; RAB3D, member RAS oncogene family; GOV; ras-related protein Rab-3D; D2 2; glioblastoma overexpressed; Rab3D upregulated with myeloid differentiation; RAB16; RAD3D;
Gene ID: 9545
mRNA Refseq: NM_004283
Protein Refseq: NP_004274
MIM: 604350
Uniprot ID: O95716
Chromosome Location: 19p13.2
Pathway: Pancreatic secretion, organism-specific biosystem; Pancreatic secretion, conserved biosystem;
Function: GTP binding; GTPase activity; GTPase binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.