"RAC3" Related Products

Recombinant Human RAC3

Cat.No.: RAC3-31284TH
Product Overview: Recombinant full length Human RAC3 ; 189 amino acids, Predicted MWt 21 kDa.
Description: The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorganization, and the activation of protein kinases.
Protein length: 189 amino acids
Molecular Weight: 21.000kDa
Source: E. coli
Tissue specificity: Highest levels in brain, also detected in heart, placenta and pancreas.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, 1mM EDTA, 0.1mM PMSF, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC
Sequence Similarities: Belongs to the small GTPase superfamily. Rho family.
Gene Name: RAC3 ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3) [ Homo sapiens ]
Official Symbol: RAC3
Synonyms: RAC3; ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3); ras-related C3 botulinum toxin substrate 3;
Gene ID: 5881
mRNA Refseq: NM_005052
Protein Refseq: NP_005043
MIM: 602050
Uniprot ID: P60763
Chromosome Location: 17q25.3
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.