"RAP1GAP" Related Products

Recombinant Human RAP1GAP, His-tagged

Cat.No.: RAP1GAP-30503TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-663 of Human RAP1GAP with an N terminal His tag. Predicted mwt: 74 kDa;
Description: This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this gene, RAP1GAP, promotes the hydrolysis of bound GTP and hence returns RAP1 to the inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitating the conversion of RAP1 from the GDP- to the GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 70 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGRE GPFPLILLPQFGGYWIEGTNHEITSIPETEPLQSPTTK VKLECNPTARIYRKHFLGKEHFNYYSLDTALGHLVFSL KYDVIGDQEHLRLLLRTKCRTYHDVIPISCLTEFPNVV QMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEELFSTNEESPAFVEFLEFLGQKVK LQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVST KLPYTEGDAQQLQRKRHIGNDIVAVVFQDENTPFVPDM IASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFG PPLPDPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMENGSGG GGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGS FAPNNPDLAKAAGISLIVPGKSPTRKKSGPFGSRRSSA IGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSS TQSSPEMPTTKNRAETAAQRAEALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDS VSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEAS EQHMPQLGC
Gene Name: RAP1GAP RAP1 GTPase activating protein [ Homo sapiens ]
Official Symbol: RAP1GAP
Synonyms: RAP1GAP; RAP1 GTPase activating protein; RAP1, GTPase activating protein 1 , RAP1GA1; rap1 GTPase-activating protein 1; KIAA0474; RAP1GAP1; RAP1GAPII;
Gene ID: 5909
mRNA Refseq: NM_001145657
Protein Refseq: NP_001139129
MIM: 600278
Uniprot ID: P47736
Chromosome Location: 1p36.1-p35
Pathway: Adaptive Immune System, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Rap1 signalling, organism-specific biosystem;
Function: GTPase activator activity; GTPase activity; Ras GTPase binding; protein binding; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.