"RBM10" Related Products

Expand
Expand

Recombinant Human RBM10, His-tagged

Cat.No.: RBM10-26514TH
Product Overview: Recombinant fragment, corresponding to amino acids 306-852 of Human RBM10 with an N terminal His tag. Predicted MWt: 61 kDa;
Description: This gene encodes a nuclear protein that belongs to a family proteins that contain an RNA-binding motif. The encoded protein associates with hnRNP proteins and may be involved in regulating alternative splicing. Defects in this gene are the cause of the X-linked recessive disorder, TARP syndrome. Alternate splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 105 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GSKRDMASNEGSRISAASVASTAIAAAQWAISQASQGGEG TWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLK GTKGPGITGTKGDPTGAGPEASLEPGADSVSMQAFSRA QPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSEL QSPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDET SGYYYDPQTGLYYDPNSQYYYNAQSQQYLYWDGERRTY VPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWARSLNKQKENFKNSFQPISSLRDDERRESATADAG YAILEKKGALAERQHTSMDLPKLASDDRPSPPRGLVAA YSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFP SKEALIRHQQLSGLHKQNLEIHRRAHLSENELEALEKNDM EQMKYRDRAAERREKYGIPEPPEPKRRKYGGISTASVD FEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIV TPIEAQTRVRGSGLGARGSSYGVTSTESYKETLHKTMVTRFNEAQ
Gene Name: RBM10 RNA binding motif protein 10 [ Homo sapiens ]
Official Symbol: RBM10
Synonyms: RBM10; RNA binding motif protein 10; RNA-binding protein 10; DXS8237E; GPATC9; GPATCH9; KIAA0122; ZRANB5;
Gene ID: 8241
mRNA Refseq: NM_001204466
Protein Refseq: NP_001191395
MIM: 300080
Uniprot ID: P98175
Chromosome Location: Xp11.3
Function: RNA binding; metal ion binding; nucleotide binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.