"RBP1" Related Products

Expand
Expand

Recombinant Human RBP1, His-tagged

Cat.No.: RBP1-30007TH
Product Overview: Recombinant full length Human RBP1 protein, with an N terminal His tag; 220 amino acids with tag; predicted Mwt: 24.7 kDa inclusive of tag
Description: This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 197 amino acids
Conjugation: HIS
Molecular Weight: 24.700kDa inclusive of tags
Source: E. coli
Tissue specificity: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:20% Glycerol, 0.32% Tris HCl, 0.03% DTT, 1.17% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMDPPAGFVRAGNPAVAA PQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWL QSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIAN LLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDL TGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDE LHLEMRVEGVVCKQVFKKVQ
Sequence Similarities: Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Gene Name: RBP1 retinol binding protein 1, cellular [ Homo sapiens ]
Official Symbol: RBP1
Synonyms: RBP1; retinol binding protein 1, cellular; retinol-binding protein 1; CRABP I; CRBP; CRBP1; CRBPI; RBPC;
Gene ID: 5947
mRNA Refseq: NM_001130992
Protein Refseq: NP_001124464
MIM: 180260
Uniprot ID: P09455
Chromosome Location: 3q21-q23
Pathway: Retinoic acid receptors-mediated signaling, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem;
Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.