"RDX" Related Products

Expand
Expand

Recombinant Human RDX

Cat.No.: RDX-29366TH
Product Overview: Recombinant full length Human Radixin with N terminal proprietary tag; Predicted MWt 90.24 kDa including the tag.
Description: Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses.
Protein length: 583 amino acids
Molecular Weight: 90.240kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLR EVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKF RAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQ HKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEM YGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLER AQLENEKEKREIAEKEKERIEREKEELMERLKQIEEQTIK AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAK SAIAKQAADQMKNQEQLAAELAEFTAKIALLEEAKKKKEE EATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQK NERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD KYKTLRQIRQGNTKQRIDEFEAM
Sequence Similarities: Contains 1 FERM domain.
Gene Name: RDX radixin [ Homo sapiens ]
Official Symbol: RDX
Synonyms: RDX; radixin; deafness, autosomal recessive 24 , DFNB24;
Gene ID: 5962
mRNA Refseq: NM_002906
Protein Refseq: NP_002897
MIM: 179410
Uniprot ID: P35241
Chromosome Location: 11q23
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; Recycling pathway of L1, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem;
Function: actin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.