Recombinant Human RGS3

• Cat.No.: RGS3-29967TH
• Product Overview: Recombinant full length Human RGS3 , containing an N-terminal proprietary tag; predicted MWt 47.23 kDa

Specification

• Description: This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTP-ase activating protein which inhibits G-protein mediated signal transduction. The protein is largely cytosolic, but G-protein activation leads to translocation of this protein to the plasma membrane. A nuclear form of this protein has also been described, but its sequence has not been identified. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature of some transcripts is not yet known.
• Protein length: 193 amino acids
• Molecular Weight: 47.230kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MLRGMYLTRNGNLQRRHTMKEAKDMKNKLGIFRRRSESPG APPAGKADKMMKSFKPTSEEALKWGESLEKLLVHKYGLAV FQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIF AEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKR IFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
• Sequence Similarities: Contains 1 C2 domain.Contains 1 PDZ (DHR) domain.Contains 1 RGS domain.

Gene Information

• Gene Name: RGS3 regulator of G-protein signaling 3 [ Homo sapiens ]
• Official Symbol: RGS3
• Synonyms: RGS3; regulator of G-protein signaling 3; regulator of G protein signalling 3; C2PA; FLJ20370; PDZ RGS3
• Gene ID: 5998
• mRNA Refseq: NM_017790
• Protein Refseq: NP_060260
• MIM: 602189
• Uniprot ID: P49796
• Chromosome Location: 9q32
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Ephrin B reverse signaling, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem
• Function: GTPase activator activity; signal transducer activity