"RILPL1" Related Products

Expand
Expand
Expand

Recombinant Human RILPL1, His-tagged

Cat.No.: RILPL1-27301TH
Product Overview: Recombinant fragment, corresponding to amino acids 116-403 of Human FLJ39378 with a N terminal His tag; predicted MWt 35kDa:
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Expressed at lower level in liver and kidney.
Form: Lyophilised:Reconstitution with 61 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGM SERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEA LQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEA DLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPV GEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNEL KSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSP QPESGIKRLFSFFSRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
Sequence Similarities: Belongs to the RILPL family.Contains 1 RILP-like domain.
Gene Name: RILPL1 Rab interacting lysosomal protein-like 1 [ Homo sapiens ]
Official Symbol: RILPL1
Synonyms: RILPL1; Rab interacting lysosomal protein-like 1; RILP-like protein 1; FLJ39378;
Gene ID: 353116
mRNA Refseq: NM_178314
Protein Refseq: NP_847884
MIM: 614092
Uniprot ID: Q5EBL4
Chromosome Location: 12q24.31

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.