"RNH1" Related Products

Expand
Expand
Expand

Recombinant Human RNH1

Cat.No.: RNH1-30985TH
Product Overview: Recombinant fragment of Human Ribonuclease Inhibitor with a N terminal proprietary tag: predicted molecular weight 35.75 kDa inclusive of tag.
Description: Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases (summarized by Lee et al.
Protein length: 92 amino acids
Molecular Weight: 35.750kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQ
Sequence Similarities: Contains 15 LRR (leucine-rich) repeats.
Gene Name: RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens ]
Official Symbol: RNH1
Synonyms: RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor , RNH; ribonuclease inhibitor; RAI;
Gene ID: 6050
mRNA Refseq: NM_002939
Protein Refseq: NP_002930
MIM: 173320
Uniprot ID: P13489
Chromosome Location: 11p15.5
Function: protein binding; ribonuclease inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.