"RORB" Related Products

Expand
Expand
Expand

Recombinant Human RORB

Cat.No.: RORB-30957TH
Product Overview: Recombinant full length Human ROR beta, isoform 1 (aa 1-459) with a N terminal proprietary tag: predicted molecular weight 76.56 kDa.
Description: The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation.
Protein length: 459 amino acids
Molecular Weight: 76.560kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQN NASYSCPRQRNCLIDRTNRNRCQHCRLQKCLALGMSRDAV KFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALAR VYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDS GQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNN GQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQ THTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRI TGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLF EGKYGGMQMFKALGSDDLVNEAFDFAKNLCSLQLTEEEIA LFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNH LDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNT LFPPLYKELFNPDCATGCK
Sequence Similarities: Belongs to the nuclear hormone receptor family. NR1 subfamily.Contains 1 nuclear receptor DNA-binding domain.
Gene Name: RORB RAR-related orphan receptor B [ Homo sapiens ]
Official Symbol: RORB
Synonyms: RORB; RAR-related orphan receptor B; nuclear receptor ROR-beta; NR1F2; ROR BETA; RZRB;
Gene ID: 6096
mRNA Refseq: NM_006914
Protein Refseq: NP_008845
MIM: 601972
Uniprot ID: Q92753
Chromosome Location: 9q22
Pathway: Circadian rhythm - mammal, organism-specific biosystem; Circadian rhythm - mammal, conserved biosystem; Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem;
Function: ligand-dependent nuclear receptor activity; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.