"RPIA" Related Products

Expand

Recombinant Human RPIA, His-tagged

Cat.No.: RPIA-31148TH
Product Overview: Recombinant full length Human RPIA with N terminal His tag; 331 amino acids with tag, Predicted MWt 35.4 kDa.
Description: The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18.
Protein length: 311 amino acids
Conjugation: HIS
Molecular Weight: 35.400kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.06% EDTA, 0.004% PMSF
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMQRPGPFSTLYGRVLAPLPG RAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVL GIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPM AYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDW KFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD GSVNMREKPFC
Sequence Similarities: Belongs to the ribose 5-phosphate isomerase family.
Gene Name: RPIA ribose 5-phosphate isomerase A [ Homo sapiens ]
Official Symbol: RPIA
Synonyms: RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase;
Gene ID: 22934
mRNA Refseq: NM_144563
Protein Refseq: NP_653164
MIM: 180430
Uniprot ID: P49247
Chromosome Location: 2p11.2
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Pentose Phosphate Pathway, organism-specific biosystem; Pentose phosphate pathway, organism-specific biosystem; Pentose phosphate pathway, conserved biosystem;
Function: isomerase activity; monosaccharide binding; ribose-5-phosphate isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.