"RPS6KB1" Related Products

Expand

Recombinant Human RPS6KB1, His-tagged

Cat.No.: RPS6KB1-29261TH
Product Overview: Recombinant fragment, corresponding to amino acids 14-525 of Human S6K with N terminal His tag; Predicted MWt 59 kDa.
Description: This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNES MDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECF ELLRVLGKGGYGKVFQVRKVTGANTGKIFAMKVLKKAM IVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGK LYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALG HLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIH DGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALM YDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEAR DLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEELL ARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDST LSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRR FIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYP METSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
Sequence Similarities: Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 1 protein kinase domain.
Gene Name: RPS6KB1 ribosomal protein S6 kinase, 70kDa, polypeptide 1 [ Homo sapiens ]
Official Symbol: RPS6KB1
Synonyms: RPS6KB1; ribosomal protein S6 kinase, 70kDa, polypeptide 1; ribosomal protein S6 kinase, 70kD, polypeptide 1 , STK14A; ribosomal protein S6 kinase beta-1; p70(S6K) alpha; PS6K; S6K1;
Gene ID: 6198
mRNA Refseq: NM_003161
Protein Refseq: NP_003152
MIM: 608938
Uniprot ID: P23443
Chromosome Location: 17q23.1
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; CDC42 signaling events, organism-specific biosystem;
Function: ATP binding; nucleotide binding; peptide binding; protein binding; protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.