"RRAD" Related Products

Recombinant Human RRAD

Cat.No.: RRAD-30772TH
Product Overview: Recombinant fragment of Human RRAD with an N terminal proprietary tag; Predicted MW 37.73kDa.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRS IVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYS VTDKGSFEKASELRVQLRRARQTDDVPIIL
Sequence Similarities: Belongs to the small GTPase superfamily. RGK family.
Gene Name: RRAD Ras-related associated with diabetes [ Homo sapiens ]
Official Symbol: RRAD
Synonyms: RRAD; Ras-related associated with diabetes; GTP-binding protein RAD; RAD; REM3;
Gene ID: 6236
mRNA Refseq: NM_001128850
Protein Refseq: NP_001122322
MIM: 179503
Uniprot ID: P55042
Chromosome Location: 16q22
Pathway: Insulin Signaling, organism-specific biosystem;
Function: GTP binding; GTPase activity; calmodulin binding; nucleotide binding; protein binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.