Recombinant Human SCP2
Cat.No. : | SCP2-31466TH |
Product Overview : | Recombinant full length Human Sterol carrier protein 2, isoform 2 with N-terminal proprietary tag. Predicted MW 41.84 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. |
Protein length : | 143 amino acids |
Molecular Weight : | 41.840kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Liver, fibroblasts, and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKL EEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGS VLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLK ITGNMGLAMKLQNLQLQPGNAKL |
Sequence Similarities : | In the N-terminal section; belongs to the thiolase family.Contains 1 SCP2 domain. |
Gene Name : | SCP2 sterol carrier protein 2 [ Homo sapiens ] |
Official Symbol : | SCP2 |
Synonyms : | SCP2; sterol carrier protein 2; non-specific lipid-transfer protein; |
Gene ID : | 6342 |
mRNA Refseq : | NM_001007098 |
Protein Refseq : | NP_001007099 |
MIM : | 184755 |
Uniprot ID : | P22307 |
Chromosome Location : | 1p32 |
Pathway : | Beta-oxidation of pristanoyl-CoA, organism-specific biosystem; Bile acid and bile salt metabolism, organism-specific biosystem; Bile acid biosynthesis, cholesterol => chenodeoxycholate, organism-specific biosystem; Bile acid biosynthesis, cholesterol => |
Function : | catalytic activity; lipid binding; propanoyl-CoA C-acyltransferase activity; protein binding; sterol binding; |
Products Types
◆ Recombinant Protein | ||
Scp2-2045M | Recombinant Mouse Scp2 Protein, His&GST-tagged | +Inquiry |
SCP2-4934R | Recombinant Rat SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCP2-02H | Recombinant Human SCP2 Protein, Myc/DDK-tagged | +Inquiry |
Scp2-5720M | Recombinant Mouse Scp2 Protein, Myc/DDK-tagged | +Inquiry |
SCP2-7944M | Recombinant Mouse SCP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket