"SEPT5" Related Products

Expand

Recombinant Human SEPT5, HIS-tagged

Cat.No.: SEPT5-31398TH
Product Overview: Recombinant fragment, corresponding to amino acids 14-369 of Human SEPT5 with N terminal His tag. Predicted mwt: 42 kDa; observed mwt: 47 kDa;
Description: This gene is a member of the septin gene family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is mapped to 22q11, the region frequently deleted in DiGeorge and velocardiofacial syndromes. A translocation involving the MLL gene and this gene has also been reported in patients with acute myeloid leukemia. Alternative splicing results in multiple transcript variants. The presence of a non-consensus polyA signal (AACAAT) in this gene also results in read-through transcription into the downstream neighboring gene (GP1BB; platelet glycoprotein Ib), whereby larger, non-coding transcripts are produced.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed at high levels in the CNS, as well as in heart and platelets (at protein level).
Form: Lyophilised:Reconstitution with 53 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))PEDKQDIDKQYVGFATLPNQVHRKSV KKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLS AEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVN NTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHC CLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADC LVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDF KQQDRELKESAPFAVIGSNTVVEAKGQRVRGRLYPWGIVE VENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRA HCIQQMTSKLTQDSRMESPIPILPLPTPDAETEKLIRM KDEELRRMQEMLQRMKQQMQDQ
Sequence Similarities: Belongs to the septin family.
Gene Name: SEPT5 septin 5 [ Homo sapiens ]
Official Symbol: SEPT5
Synonyms: SEPT5; septin 5; peanut like 1 (Drosophila) , PNUTL1; septin-5; H5; HCDCREL 1;
Gene ID: 5413
mRNA Refseq: NM_001009939
Protein Refseq: NP_001009939
MIM: 602724
Uniprot ID: Q99719
Chromosome Location: 22q11.2
Pathway: Parkinsons disease, organism-specific biosystem;
Function: GTP binding; GTPase activity; nucleotide binding; protein binding; structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.