"SERPINA6" Related Products

Expand
Expand
Expand

Recombinant Human SERPINA6

Cat.No.: SERPINA6-26357TH
Product Overview: Recombinant full length mature Human Cortisol Binding Globulin with N terminal proprietary tag; Predicted MW 68.24 kDa
Description: This gene encodes an alpha-globulin protein with corticosteroid-binding properties. This is the major transport protein for glucorticoids and progestins in the blood of most vertebrates. The gene localizes to a chromosomal region containing several closely related serine protease inhibitors which may have evolved by duplication events.
Protein length: 383 amino acids
Molecular Weight: 68.240kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKN IFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSE TEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLES FSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKI VDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGT VFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIP KVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKS SKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQP FIIMIFDHFTWSSLFLARVMNPV
Sequence Similarities: Belongs to the serpin family.
Gene Name: SERPINA6 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 [ Homo sapiens ]
Official Symbol: SERPINA6
Synonyms: SERPINA6; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6; CBG, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 6; corticosteroid-binding globulin; corticosteroid bindin
Gene ID: 866
mRNA Refseq: NM_001756
Protein Refseq: NP_001747
MIM: 122500
Uniprot ID: P08185
Chromosome Location: 14q31-q32.1
Function: serine-type endopeptidase inhibitor activity; steroid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.