"SFRP4" Related Products

Expand
Expand

Recombinant Human SFRP4

Cat.No.: SFRP4-30079TH
Product Overview: Recombinant fragment of Human SFRP4 with N terminal proprietary tag, 36.85kDa inclusive of tag.
Description: Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression.
Protein length: 102 amino acids
Molecular Weight: 36.850kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, exp
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILP HQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEER LQEQRRTVQDKKKTAGRTSRSN
Sequence Similarities: Belongs to the secreted frizzled-related protein (sFRP) family.Contains 1 FZ (frizzled) domain.Contains 1 NTR domain.
Gene Name: SFRP4 secreted frizzled-related protein 4 [ Homo sapiens ]
Official Symbol: SFRP4
Synonyms: SFRP4; secreted frizzled-related protein 4; FRP 4; FRPHE; frpHE;
Gene ID: 6424
mRNA Refseq: NM_003014
Protein Refseq: NP_003005
MIM: 606570
Uniprot ID: Q6FHJ7
Chromosome Location: 7p14.1
Pathway: Adipogenesis, organism-specific biosystem; Wnt Signaling Pathway, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function: PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.