Recombinant Human SFTPC
Cat.No. : | SFTPC-30425TH |
Product Overview : | Recombinant full length Human SFTPC with N terminal proprietary tag; Predicted MWt 47.41 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified. |
Protein length : | 197 amino acids |
Molecular Weight : | 47.410kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVV VVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC CYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSK LGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI |
Sequence Similarities : | Contains 1 BRICHOS domain. |
Gene Name : | SFTPC surfactant protein C [ Homo sapiens ] |
Official Symbol : | SFTPC |
Synonyms : | SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C; |
Gene ID : | 6440 |
mRNA Refseq : | NM_001172357 |
Protein Refseq : | NP_001165828 |
MIM : | 178620 |
Uniprot ID : | P11686 |
Chromosome Location : | 8p21 |
Function : | protein homodimerization activity; |
Products Types
◆ Recombinant Protein | ||
SFTPC-1517H | Recombinant Human SFTPC Protein (24-58 aa), His-tagged | +Inquiry |
Sftpc-5817M | Recombinant Mouse Sftpc Protein, Myc/DDK-tagged | +Inquiry |
SFTPC-810B | Recombinant Bovine SFTPC Protein (25-58 aa), GST-tagged | +Inquiry |
Sftpc-2055M | Recombinant Mouse Sftpc Protein, His-tagged | +Inquiry |
SFTPC-5018R | Recombinant Rat SFTPC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionEnvironmental factors affect SFTPC expression, impacting lung defense mechanisms and susceptibility to lung diseases.
Molecular mechanisms of SFTPC-related interstitial lung disease involve disrupted surfactant metabolism and increased lung tissue inflammation.
SFTPC is crucial in the lung's response to injury and infection, modulating inflammatory responses and tissue repair.
Therapeutic strategies targeting SFTPC can be effective in treating lung conditions like pulmonary fibrosis and ARDS by restoring surfactant function and reducing inflammation.
SFTPC deficiency alters surfactant composition and function, compromising lung elasticity and gas exchange in the alveolar space.
Mutations in SFTPC impair lung function and development, leading to neonatal respiratory disorders by disrupting surfactant homeostasis.
SFTPC collaborates with other surfactant proteins and lipids to maintain lung stability and prevent alveolar collapse.
Customer Reviews (3)
Write a reviewEfficient protein purification; excellent yield and purity.
Invaluable expertise in protein engineering; exceptional service.
Trustworthy peptide synthesis; aids in our peptide-based research.
Ask a Question for All SFTPC Products
Required fields are marked with *
My Review for All SFTPC Products
Required fields are marked with *
Inquiry Basket