Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SFTPC

Cat.No. : SFTPC-30425TH
Product Overview : Recombinant full length Human SFTPC with N terminal proprietary tag; Predicted MWt 47.41 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.
Protein length : 197 amino acids
Molecular Weight : 47.410kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVV VVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC CYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSK LGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Sequence Similarities : Contains 1 BRICHOS domain.
Gene Name : SFTPC surfactant protein C [ Homo sapiens ]
Official Symbol : SFTPC
Synonyms : SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C;
Gene ID : 6440
mRNA Refseq : NM_001172357
Protein Refseq : NP_001165828
MIM : 178620
Uniprot ID : P11686
Chromosome Location : 8p21
Function : protein homodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How do environmental factors, such as pollutants or pathogens, influence SFTPC expression and function? 12/23/2021

Environmental factors affect SFTPC expression, impacting lung defense mechanisms and susceptibility to lung diseases.

What are the molecular mechanisms underlying SFTPC-related interstitial lung disease in adults and children? 09/11/2021

Molecular mechanisms of SFTPC-related interstitial lung disease involve disrupted surfactant metabolism and increased lung tissue inflammation.

What role does SFTPC play in the lung's response to injury and infection, including inflammation and repair processes? 08/30/2020

SFTPC is crucial in the lung's response to injury and infection, modulating inflammatory responses and tissue repair.

What therapeutic strategies can be developed targeting SFTPC to treat lung diseases like pulmonary fibrosis and acute respiratory distress syndrome (ARDS)? 06/24/2020

Therapeutic strategies targeting SFTPC can be effective in treating lung conditions like pulmonary fibrosis and ARDS by restoring surfactant function and reducing inflammation.

How does SFTPC deficiency affect the surfactant composition and function in the alveolar space? 08/06/2018

SFTPC deficiency alters surfactant composition and function, compromising lung elasticity and gas exchange in the alveolar space.

What is the impact of SFTPC mutations on lung function and development, particularly in neonatal respiratory disorders? 04/02/2018

Mutations in SFTPC impair lung function and development, leading to neonatal respiratory disorders by disrupting surfactant homeostasis.

How does SFTPC interact with other surfactant proteins and lipids to maintain lung homeostasis? 02/04/2018

SFTPC collaborates with other surfactant proteins and lipids to maintain lung stability and prevent alveolar collapse.

Customer Reviews (3)

Write a review
Reviews
07/22/2022

    Efficient protein purification; excellent yield and purity.

    03/12/2020

      Invaluable expertise in protein engineering; exceptional service.

      05/24/2019

        Trustworthy peptide synthesis; aids in our peptide-based research.

        Ask a Question for All SFTPC Products

        Required fields are marked with *

        My Review for All SFTPC Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends