"SHMT1" Related Products

Expand
Expand

Recombinant Human SHMT1, His-tagged

Cat.No.: SHMT1-30066TH
Product Overview: Recombinant full length Human SHMT1 with an N terminal His tag; 503 amino acids with a predicted MWt of 55.2kDa including the tag.
Description: This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.
Protein length: 483 amino acids
Conjugation: HIS
Molecular Weight: 55.200kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTMPVNGAHKDADLWSSHDK MLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRA LQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADE NGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLR GCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGL QGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSE ALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEAC SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAA VQALREEVESFASFFPLPGLPDF
Sequence Similarities: Belongs to the SHMT family.
Gene Name: SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ]
Official Symbol: SHMT1
Synonyms: SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT;
Gene ID: 6470
mRNA Refseq: NM_004169
Protein Refseq: NP_004160
MIM: 182144
Uniprot ID: P34896
Chromosome Location: 17p11.2
Pathway: C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem;
Function: L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.