Recombinant Human SHMT1, His-tagged
Cat.No. : | SHMT1-30066TH |
Product Overview : | Recombinant full length Human SHMT1 with an N terminal His tag; 503 amino acids with a predicted MWt of 55.2kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined. |
Protein length : | 483 amino acids |
Conjugation : | HIS |
Molecular Weight : | 55.200kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTMPVNGAHKDADLWSSHDK MLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRA VLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRA LQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMG LDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGY INYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADE NGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLR GCRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPGL QGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSE ALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEAC SIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQK VAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAA VQALREEVESFASFFPLPGLPDF |
Sequence Similarities : | Belongs to the SHMT family. |
Gene Name : | SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ] |
Official Symbol : | SHMT1 |
Synonyms : | SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT; |
Gene ID : | 6470 |
mRNA Refseq : | NM_004169 |
Protein Refseq : | NP_004160 |
MIM : | 182144 |
Uniprot ID : | P34896 |
Chromosome Location : | 17p11.2 |
Pathway : | C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem; |
Function : | L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity; |
Products Types
◆ Recombinant Protein | ||
Shmt1-5868M | Recombinant Mouse Shmt1 Protein, Myc/DDK-tagged | +Inquiry |
SHMT1-4012R | Recombinant Rhesus Macaque SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-8158M | Recombinant Mouse SHMT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SHMT1-0576H | Recombinant Human SHMT1 Protein (D11-L480), Tag Free | +Inquiry |
SHMT1-0577H | Recombinant Human SHMT1 Protein (D11-L480), His tagged | +Inquiry |
◆ Lysates | ||
SHMT1-1854HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
SHMT1-1855HCL | Recombinant Human SHMT1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SHMT1 Products
Required fields are marked with *
My Review for All SHMT1 Products
Required fields are marked with *
0
Inquiry Basket