Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SHMT1, His-tagged

Cat.No. : SHMT1-31357TH
Product Overview : Recombinant fragment, corresponding to amino acids 184-483 of Human SHMT1, with N terminal His tag, 300aa, MWt 35kDa,
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the cellular form of serine hydroxymethyltransferase, a pyridoxal phosphate-containing enzyme that catalyzes the reversible conversion of serine and tetrahydrofolate to glycine and 5,10-methylene tetrahydrofolate. This reaction provides one carbon units for synthesis of methionine, thymidylate, and purines in the cytoplasm. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Alternative splicing of this gene results in 2 transcript variants encoding 2 different isoforms. Additional transcript variants have been described, but their biological validity has not been determined.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 114 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGA YLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRG CRAGMIFYRKGVKSVDPKTGKEILYNLESLINSAVFPG LQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRA LSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVL EACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLE KDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLA GDKYQAAVQALREEVESFASLFPLPGLPDF
Sequence Similarities : Belongs to the SHMT family.
Gene Name : SHMT1 serine hydroxymethyltransferase 1 (soluble) [ Homo sapiens ]
Official Symbol : SHMT1
Synonyms : SHMT1; serine hydroxymethyltransferase 1 (soluble); serine hydroxymethyltransferase, cytosolic; 14 kDa protein; CSHMT; cytoplasmic serine hydroxymethyltransferase; MGC15229; MGC24556; SHMT;
Gene ID : 6470
mRNA Refseq : NM_004169
Protein Refseq : NP_004160
MIM : 182144
Uniprot ID : P34896
Chromosome Location : 17p11.2
Pathway : C1-unit interconversion, eukaryotes, organism-specific biosystem; C1-unit interconversion, eukaryotes, conserved biosystem; Carnitine synthesis, organism-specific biosystem; Cyanoamino acid metabolism, organism-specific biosystem; Cyanoamino acid metabolism, conserved biosystem;
Function : L-allo-threonine aldolase activity; amino acid binding; glycine hydroxymethyltransferase activity; glycine hydroxymethyltransferase activity; protein homodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All SHMT1 Products

Required fields are marked with *

My Review for All SHMT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends