"SLC7A11" Related Products

Recombinant Human SLC7A11 protein, GST-tagged

Cat.No.: SLC7A11-30700TH
Product Overview: Recombinant Human SLC7A11(1 a.a. - 501 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 81.8 kDa
AA Sequence: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SLC7A11 solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11 [ Homo sapiens ]
Official Symbol: SLC7A11
Synonyms: SLC7A11; solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; cystine/glutamate transporter; xCT; amino acid transport system xc-; solute carrier family 7 member 11; calcium channel blocker resistance protein CCBR1; solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; CCBR1;
Gene ID: 23657
mRNA Refseq: NM_014331
Protein Refseq: NP_055146
MIM: 607933
UniProt ID: Q9UPY5
Chromosome Location: 4q28-q32
Function: amino acid transmembrane transporter activity; cystine:glutamate antiporter activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.