"SMS" Related Products

Expand
Expand

Recombinant Human SMS, His-tagged

Cat.No. : SMS-30398TH
Product Overview : Recombinant full length Human Spermine synthase with N terminal His tag; 390 amino acids with tag, Predicted MWt 43.8 kDa.
Description : The protein encoded by this gene belongs to the spermidine/spermine synthases family. This gene encodes an ubiquitous enzyme of polyamine metabolism.
Protein length : 366 amino acids
Conjugation : HIS
Molecular Weight : 43.800kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMAAARHSTLDFMLGAK ADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNG SFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEER MKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDI DEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLA YTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMV TMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDC IPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLR LILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLY CPVEFSKEIVCVPSYLELWVFYTVWKKAKP
Sequence Similarities : Belongs to the spermidine/spermine synthase family.
Gene Name : SMS spermine synthase [ Homo sapiens ]
Official Symbol : SMS
Synonyms : SMS; spermine synthase; Snyder Robinson X linked mental retardation syndrome , SRS; MRSR; SPMSY; SpS;
Gene ID : 6611
mRNA Refseq : NM_004595
Protein Refseq : NP_004586
MIM : 300105
Uniprot ID : P52788
Chromosome Location : Xp22.1
Pathway : Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Glutathione metabolism, organism-specific biosystem;
Function : spermidine synthase activity; spermine synthase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.