"SNTA1" Related Products

Recombinant Human SNTA1, His-tagged

Cat.No.: SNTA1-29288TH
Product Overview: Recombinant full length Human Syntrophin alpha 1 with N terminal His tag; 528 amino acids with tag, Predicted MWt 56.3 kDa.
Description: Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
Protein length: 505 amino acids
Conjugation: HIS
Molecular Weight: 56.300kDa inclusive of tags
Source: E. coli
Tissue specificity: High expression in skeletal muscle and heart. Low expression in brain, pancreas, liver, kidney and lung. Not detected in placenta.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSMASGRRAPRTGLLELRA GAGSGAGGERWQRVLLSLAEDVLTVSPADGDPGPEPGAPR EQEPAQLNGAAEPGAGPPQLPEALLLQRRRVTVRKADAGG LGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILS VNGEDLSSATHDEAVQVLKKTGKEVVLEVKYMKDVSPYFK NSTGGTSVGWDSPPASPLQRQPSSPGPTPRNFSEAKHMSL KMAYVSKRCTPNDPEPRYLEICSADGQDTLFLRAKDEASA RSWATAIQAQVNTLTPRVKDELQALLAATSTAGSQDIKQI GWLTEQLPSGGTAPTLALLTEKELLLYLSLPETREALSRP ARTAPLIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVD THLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWN GRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSS DDGASLLFLDFGGAEGEIQLDLHSCPKTIVFIIHSFLSAK VTRLGLLA
Sequence Similarities: Belongs to the syntrophin family.Contains 1 PDZ (DHR) domain.Contains 2 PH domains.Contains 1 SU (syntrophin unique) domain.
Gene Name: SNTA1 syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component) [ Homo sapiens ]
Official Symbol: SNTA1
Synonyms: SNTA1; syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component); SNT1, syntrophin, alpha 1 (dystrophin associated protein A1, 59kD, acidic component); alpha-1-syntrophin; pro TGF alpha cytoplasmic domain interacting protein 1; TACI
Gene ID: 6640
mRNA Refseq: NM_003098
Protein Refseq: NP_003089
MIM: 601017
Uniprot ID: Q13424
Chromosome Location: 20q11.2
Pathway: Signaling mediated by p38-gamma and p38-delta, organism-specific biosystem;
Function: PDZ domain binding; actin binding; calmodulin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.