Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human SORD, His-tagged

Cat.No. : SORD-30012TH
Product Overview : Recombinant fragment, corresponding to amino acids 163-357 of Human Sorbitol Dehydrogenase with an N terminal His tag; Predicted MWt 22kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Sorbitol dehydrogenase (SORD; EC 1.1.1.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level).
Form : Lyophilised:Reconstitute with 77 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVV TDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSE MTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSV NVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQN P
Sequence Similarities : Belongs to the zinc-containing alcohol dehydrogenase family.
Gene Name : SORD sorbitol dehydrogenase [ Homo sapiens ]
Official Symbol : SORD
Synonyms : SORD; sorbitol dehydrogenase;
Gene ID : 6652
mRNA Refseq : NM_003104
Protein Refseq : NP_003095
MIM : 182500
Uniprot ID : Q00796
Chromosome Location : 15q15-q21.1
Pathway : Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : L-iditol 2-dehydrogenase activity; L-iditol 2-dehydrogenase activity; NAD binding; metal ion binding; oxidoreductase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
What diseases are SORD proteins associated with? 09/22/2022

At present, the association between SORD protein and disease is not well understood, and further research is needed to explore its role in specific diseases.

How are SORD proteins related to antioxidants? 06/22/2022

SORD protein is involved in the antioxidant process in cells, and may indirectly affect the antioxidant capacity in cells by regulating heptitol-6-phosphate metabolism.

Are SORD protein mutations associated with genetic disorders? 06/14/2022

There is no clear information on the association between SORD protein mutations and inherited diseases.

Does the loss of function of the SORD protein lead to disease? 09/04/2021

There is no evidence that the lack of SORD protein function directly leads to the development of disease. However, it may affect the normal function of the glucose metabolism pathway.

How is SORD protein related to metabolic diseases? 12/07/2020

The protein may play a role in metabolic pathways related to metabolic diseases (e.g., diabetes mellitus and metabolic syndrome), but the specific relationship still needs to be further studied.

What is the function of SORD protein in the human body? 03/03/2020

SORD protein is involved in the heptylol-6-phosphoreductase reaction in the glucose metabolism pathway, which converts heptitol-6-phosphate to cholesterol alcohol.

Customer Reviews (3)

Write a review
Reviews
01/12/2023

    The stability of SORD products allows them to cope with different experimental conditions and modes of operation.

    12/03/2021

      SORD has a high specific activity and can exert strong biological effects at low concentrations.

      07/05/2021

        When experiments were performed with SORD, the reproducibility of the results was excellent.

        Ask a Question for All SORD Products

        Required fields are marked with *

        My Review for All SORD Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends