Recombinant Human SORD, His-tagged
Cat.No. : | SORD-30012TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 163-357 of Human Sorbitol Dehydrogenase with an N terminal His tag; Predicted MWt 22kDa. |
- Specification
- Gene Information
- Related Products
Description : | Sorbitol dehydrogenase (SORD; EC 1.1.1. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Expressed in kidney and epithelial cells of both benign and malignant prostate tissue. Expressed in epididymis (at protein level). |
Form : | Lyophilised:Reconstitute with 77 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVV TDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQL GCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSE MTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSV NVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQN P |
Sequence Similarities : | Belongs to the zinc-containing alcohol dehydrogenase family. |
Gene Name : | SORD sorbitol dehydrogenase [ Homo sapiens ] |
Official Symbol : | SORD |
Synonyms : | SORD; sorbitol dehydrogenase; |
Gene ID : | 6652 |
mRNA Refseq : | NM_003104 |
Protein Refseq : | NP_003095 |
MIM : | 182500 |
Uniprot ID : | Q00796 |
Chromosome Location : | 15q15-q21.1 |
Pathway : | Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function : | L-iditol 2-dehydrogenase activity; L-iditol 2-dehydrogenase activity; NAD binding; metal ion binding; oxidoreductase activity; |
Products Types
◆ Recombinant Protein | ||
SORD-4224R | Recombinant Rhesus Macaque SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-5330R | Recombinant Rat SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-8575M | Recombinant Mouse SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
SORD-701C | Recombinant Cynomolgus Monkey SORD Protein, His (Fc)-Avi-tagged | +Inquiry |
Sord-6046M | Recombinant Mouse Sord Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
SORD-1569HCL | Recombinant Human SORD 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionAt present, the association between SORD protein and disease is not well understood, and further research is needed to explore its role in specific diseases.
SORD protein is involved in the antioxidant process in cells, and may indirectly affect the antioxidant capacity in cells by regulating heptitol-6-phosphate metabolism.
There is no clear information on the association between SORD protein mutations and inherited diseases.
There is no evidence that the lack of SORD protein function directly leads to the development of disease. However, it may affect the normal function of the glucose metabolism pathway.
The protein may play a role in metabolic pathways related to metabolic diseases (e.g., diabetes mellitus and metabolic syndrome), but the specific relationship still needs to be further studied.
SORD protein is involved in the heptylol-6-phosphoreductase reaction in the glucose metabolism pathway, which converts heptitol-6-phosphate to cholesterol alcohol.
Customer Reviews (3)
Write a reviewThe stability of SORD products allows them to cope with different experimental conditions and modes of operation.
SORD has a high specific activity and can exert strong biological effects at low concentrations.
When experiments were performed with SORD, the reproducibility of the results was excellent.
Ask a Question for All SORD Products
Required fields are marked with *
My Review for All SORD Products
Required fields are marked with *
Inquiry Basket