Recombinant Human SPR, His-tagged
| Cat.No. : | SPR-30400TH |
| Product Overview : | Recombinant full length Human SPR with N terminal His tag; 281 aa, 30.2 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. |
| Protein length : | 261 amino acids |
| Conjugation : | HIS |
| Molecular Weight : | 30.200kDa inclusive of tags |
| Source : | E. coli |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituent:0.32% Tris HCl |
| Storage : | Please see Notes section |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEGGLGRAVCLLTGASRGFG RTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINN AGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRK GLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD K |
| Sequence Similarities : | Belongs to the sepiapterin reductase family. |
| Gene Name : | SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ] |
| Official Symbol : | SPR |
| Synonyms : | SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1; |
| Gene ID : | 6697 |
| mRNA Refseq : | NM_003124 |
| Protein Refseq : | NP_003115 |
| MIM : | 182125 |
| Uniprot ID : | P35270 |
| Chromosome Location : | 2p14-p12 |
| Pathway : | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem; |
| Function : | NADP binding; aldo-keto reductase (NADP) activity; oxidoreductase activity; sepiapterin reductase activity; |
Products Types
| ◆ Recombinant Protein | ||
| SPR-4262R | Recombinant Rhesus Macaque SPR Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPR-0242H | Recombinant Human SPR Protein (M1-K261), His tagged | +Inquiry |
| SPR-2090H | Recombinant Human SPR Protein, His (Fc)-Avi-tagged | +Inquiry |
| Spr-205M | Recombinant Mouse Spr Protein, His-tagged | +Inquiry |
| SPR-0243H | Recombinant Human SPR Protein (M1-K261), Tag Free | +Inquiry |
| ◆ Lysates | ||
| SPR-1499HCL | Recombinant Human SPR 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
