"SPR" Related Products

Expand

Recombinant Human SPR, His-tagged

Cat.No.: SPR-30400TH
Product Overview: Recombinant full length Human SPR with N terminal His tag; 281 aa, 30.2 kDa.
Description: This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1.
Protein length: 261 amino acids
Conjugation: HIS
Molecular Weight: 30.200kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituent:0.32% Tris HCl
Storage: Please see Notes section
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEGGLGRAVCLLTGASRGFG RTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINN AGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLK AFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRK GLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD K
Sequence Similarities: Belongs to the sepiapterin reductase family.
Gene Name: SPR sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) [ Homo sapiens ]
Official Symbol: SPR
Synonyms: SPR; sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase); sepiapterin reductase; SDR38C1; short chain dehydrogenase/reductase family 38C; member 1;
Gene ID: 6697
mRNA Refseq: NM_003124
Protein Refseq: NP_003115
MIM: 182125
Uniprot ID: P35270
Chromosome Location: 2p14-p12
Pathway: Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nitric oxide, organism-specific biosystem;
Function: NADP binding; aldo-keto reductase (NADP) activity; oxidoreductase activity; sepiapterin reductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.