"SRGN" Related Products

Expand
Expand

Recombinant Human SRGN

Cat.No.: SRGN-31397TH
Product Overview: Recombinant full length Human SRGN with N terminal proprietary tag; Predicted MW 43.49kDa.
Description: This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.
Protein length: 158 amino acids
Molecular Weight: 43.490kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRC NPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRI QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
Sequence Similarities: Belongs to the serglycin family.
Gene Name: SRGN serglycin [ Homo sapiens ]
Official Symbol: SRGN
Synonyms: SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan;
Gene ID: 5552
mRNA Refseq: NM_002727
Protein Refseq: NP_002718
MIM: 177040
Uniprot ID: P10124
Chromosome Location: 10q22.1
Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem;
Function: collagen binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.