Recombinant Human SRGN
Cat.No. : | SRGN-31397TH |
Product Overview : | Recombinant full length Human SRGN with N terminal proprietary tag; Predicted MW 43.49kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene. |
Protein length : | 158 amino acids |
Molecular Weight : | 43.490kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRC NPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRI QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
Sequence Similarities : | Belongs to the serglycin family. |
Gene Name : | SRGN serglycin [ Homo sapiens ] |
Official Symbol : | SRGN |
Synonyms : | SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan; |
Gene ID : | 5552 |
mRNA Refseq : | NM_002727 |
Protein Refseq : | NP_002718 |
MIM : | 177040 |
Uniprot ID : | P10124 |
Chromosome Location : | 10q22.1 |
Pathway : | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; |
Function : | collagen binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
SRGN-2734H | Recombinant Human SRGN Protein, His-tagged | +Inquiry |
SRGN-8716M | Recombinant Mouse SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
SRGN-2836H | Recombinant Human SRGN Protein, His-tagged, OVA Conjugated | +Inquiry |
SRGN-5400R | Recombinant Rat SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
SRGN-4280R | Recombinant Rhesus Macaque SRGN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SRGN-1119HCL | Recombinant Human SRGN cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket