"SRR" Related Products

Expand

Recombinant Human SRR, His-tagged

Cat.No.: SRR-31354TH
Product Overview: Recombinant full length Human Serine racemase with N terminal His tag; 364 amino acids with tag, Predicted MWt 39.1 kDa.
Description: catalyzes the conversion of L-serine to D-serine
Protein length: 340 amino acids
Conjugation: HIS
Molecular Weight: 39.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Brain: expressed at high levels in hippocampus and corpus callosum, intermediate levels in substantia nigra and caudate, and low levels in amygdala, thalamus, and subthalamic nuclei. Expressed in heart, skeletal muscle, kidney and liver.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMCAQYCISFADVEKAH INIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFK IRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAK LEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRE NVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPL VDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADD CYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLV DDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQ HFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQ SVSV
Sequence Similarities: Belongs to the serine/threonine dehydratase family.
Gene Name: SRR serine racemase [ Homo sapiens ]
Official Symbol: SRR
Synonyms: SRR; serine racemase; ILV1; ISO1;
Gene ID: 63826
mRNA Refseq: NM_021947
Protein Refseq: NP_068766
MIM: 606477
Uniprot ID: Q9GZT4
Chromosome Location: 17p13
Pathway: Glycine, serine and threonine metabolism, organism-specific biosystem; Glycine, serine and threonine metabolism, conserved biosystem;
Function: ATP binding; ATP binding; D-serine ammonia-lyase activity; L-serine ammonia-lyase activity; PDZ domain binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.